Anti KMT5B pAb (ATL-HPA063648)

Atlas Antibodies

Catalog No.:
ATL-HPA063648-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: lysine methyltransferase 5B
Gene Name: KMT5B
Alternative Gene Name: CGI-85, SUV420H1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045098: 86%, ENSRNOG00000016790: 87%
Entrez Gene ID: 51111
Uniprot ID: Q4FZB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
Gene Sequence DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
Gene ID - Mouse ENSMUSG00000045098
Gene ID - Rat ENSRNOG00000016790
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KMT5B pAb (ATL-HPA063648)
Datasheet Anti KMT5B pAb (ATL-HPA063648) Datasheet (External Link)
Vendor Page Anti KMT5B pAb (ATL-HPA063648) at Atlas Antibodies

Documents & Links for Anti KMT5B pAb (ATL-HPA063648)
Datasheet Anti KMT5B pAb (ATL-HPA063648) Datasheet (External Link)
Vendor Page Anti KMT5B pAb (ATL-HPA063648)