Anti KLRG1 pAb (ATL-HPA076494)

Atlas Antibodies

Catalog No.: ATL-HPA076494-25

Protein Description: killer cell lectin-like receptor subfamily G, member 1
Gene Name: KLRG1
Alternative Gene Name: 2F1, CLEC15A, MAFA, MAFA-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030114: 57%, ENSRNOG00000050763: 52%
Entrez Gene ID: 10219
Uniprot ID: Q96E93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE
• Gene Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE
• Gene ID - Mouse: ENSMUSG00000030114
• Gene ID - Rat: ENSRNOG00000050763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.