Anti KLRF1 pAb (ATL-HPA054038)

Atlas Antibodies

Catalog No.:
ATL-HPA054038-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: killer cell lectin like receptor F1
Gene Name: KLRF1
Alternative Gene Name: CLEC5C, NKp80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071158: 32%, ENSRNOG00000014975: 27%
Entrez Gene ID: 51348
Uniprot ID: Q9NZS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER
Gene Sequence GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER
Gene ID - Mouse ENSMUSG00000071158
Gene ID - Rat ENSRNOG00000014975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLRF1 pAb (ATL-HPA054038)
Datasheet Anti KLRF1 pAb (ATL-HPA054038) Datasheet (External Link)
Vendor Page Anti KLRF1 pAb (ATL-HPA054038) at Atlas Antibodies

Documents & Links for Anti KLRF1 pAb (ATL-HPA054038)
Datasheet Anti KLRF1 pAb (ATL-HPA054038) Datasheet (External Link)
Vendor Page Anti KLRF1 pAb (ATL-HPA054038)