Anti KLRB1 pAb (ATL-HPA039113)

Atlas Antibodies

Catalog No.:
ATL-HPA039113-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: killer cell lectin-like receptor subfamily B, member 1
Gene Name: KLRB1
Alternative Gene Name: CD161, CLEC5B, hNKR-P1A, NKR, NKR-P1, NKR-P1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030325: 44%, ENSRNOG00000057410: 44%
Entrez Gene ID: 3820
Uniprot ID: Q12918
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
Gene Sequence KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
Gene ID - Mouse ENSMUSG00000030325
Gene ID - Rat ENSRNOG00000057410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLRB1 pAb (ATL-HPA039113)
Datasheet Anti KLRB1 pAb (ATL-HPA039113) Datasheet (External Link)
Vendor Page Anti KLRB1 pAb (ATL-HPA039113) at Atlas Antibodies

Documents & Links for Anti KLRB1 pAb (ATL-HPA039113)
Datasheet Anti KLRB1 pAb (ATL-HPA039113) Datasheet (External Link)
Vendor Page Anti KLRB1 pAb (ATL-HPA039113)
Citations for Anti KLRB1 pAb (ATL-HPA039113) – 1 Found
Tsuchiya, Kazuyo; Ikeda, Takuto; Batmunkh, Baatarsuren; Choijookhuu, Narantsog; Ishizaki, Hidenobu; Hotokezaka, Masayuki; Hishikawa, Yoshitaka; Nanashima, Atsushi. Frequency of CD4+CD161+ T Cell and Interleukin-10 Expression in Inflammatory Bowel Diseases. Acta Histochemica Et Cytochemica. 2017;50(1):21-28.  PubMed