Anti KLRB1 pAb (ATL-HPA039113)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039113-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: KLRB1
Alternative Gene Name: CD161, CLEC5B, hNKR-P1A, NKR, NKR-P1, NKR-P1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030325: 44%, ENSRNOG00000057410: 44%
Entrez Gene ID: 3820
Uniprot ID: Q12918
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH |
| Gene Sequence | KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH |
| Gene ID - Mouse | ENSMUSG00000030325 |
| Gene ID - Rat | ENSRNOG00000057410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KLRB1 pAb (ATL-HPA039113) | |
| Datasheet | Anti KLRB1 pAb (ATL-HPA039113) Datasheet (External Link) |
| Vendor Page | Anti KLRB1 pAb (ATL-HPA039113) at Atlas Antibodies |
| Documents & Links for Anti KLRB1 pAb (ATL-HPA039113) | |
| Datasheet | Anti KLRB1 pAb (ATL-HPA039113) Datasheet (External Link) |
| Vendor Page | Anti KLRB1 pAb (ATL-HPA039113) |
| Citations for Anti KLRB1 pAb (ATL-HPA039113) – 1 Found |
| Tsuchiya, Kazuyo; Ikeda, Takuto; Batmunkh, Baatarsuren; Choijookhuu, Narantsog; Ishizaki, Hidenobu; Hotokezaka, Masayuki; Hishikawa, Yoshitaka; Nanashima, Atsushi. Frequency of CD4+CD161+ T Cell and Interleukin-10 Expression in Inflammatory Bowel Diseases. Acta Histochemica Et Cytochemica. 2017;50(1):21-28. PubMed |