Anti KLLN pAb (ATL-HPA074502)

Atlas Antibodies

SKU:
ATL-HPA074502-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: killin, p53-regulated DNA replication inhibitor
Gene Name: KLLN
Alternative Gene Name: killin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015468: 27%, ENSRNOG00000019964: 29%
Entrez Gene ID: 100144748
Uniprot ID: B2CW77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLL
Gene Sequence SSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLL
Gene ID - Mouse ENSMUSG00000015468
Gene ID - Rat ENSRNOG00000019964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KLLN pAb (ATL-HPA074502)
Datasheet Anti KLLN pAb (ATL-HPA074502) Datasheet (External Link)
Vendor Page Anti KLLN pAb (ATL-HPA074502) at Atlas Antibodies

Documents & Links for Anti KLLN pAb (ATL-HPA074502)
Datasheet Anti KLLN pAb (ATL-HPA074502) Datasheet (External Link)
Vendor Page Anti KLLN pAb (ATL-HPA074502)