Anti KLHL34 pAb (ATL-HPA060287)

Atlas Antibodies

SKU:
ATL-HPA060287-25
  • Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: kelch-like family member 34
Gene Name: KLHL34
Alternative Gene Name: FLJ34960, RP11-450P7.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047485: 83%, ENSRNOG00000024479: 84%
Entrez Gene ID: 257240
Uniprot ID: Q8N239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DRGVVYISGGKAGRGEGGASSLRDLYVLGPEEQVWSKKAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDPGADQWTR
Gene Sequence DRGVVYISGGKAGRGEGGASSLRDLYVLGPEEQVWSKKAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDPGADQWTR
Gene ID - Mouse ENSMUSG00000047485
Gene ID - Rat ENSRNOG00000024479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KLHL34 pAb (ATL-HPA060287)
Datasheet Anti KLHL34 pAb (ATL-HPA060287) Datasheet (External Link)
Vendor Page Anti KLHL34 pAb (ATL-HPA060287) at Atlas Antibodies

Documents & Links for Anti KLHL34 pAb (ATL-HPA060287)
Datasheet Anti KLHL34 pAb (ATL-HPA060287) Datasheet (External Link)
Vendor Page Anti KLHL34 pAb (ATL-HPA060287)