Anti KLHL33 pAb (ATL-HPA056560)

Atlas Antibodies

Catalog No.:
ATL-HPA056560-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kelch-like family member 33
Gene Name: KLHL33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090799: 81%, ENSRNOG00000025868: 87%
Entrez Gene ID: 123103
Uniprot ID: A6NCF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSPARCLALFPMAEAPGLERLWSKARHYLLTHLPAVALCPAFPSLPAACLAELLDSDELHVQEEFEAFVAARCWLAANPETQES
Gene Sequence LSPARCLALFPMAEAPGLERLWSKARHYLLTHLPAVALCPAFPSLPAACLAELLDSDELHVQEEFEAFVAARCWLAANPETQES
Gene ID - Mouse ENSMUSG00000090799
Gene ID - Rat ENSRNOG00000025868
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLHL33 pAb (ATL-HPA056560)
Datasheet Anti KLHL33 pAb (ATL-HPA056560) Datasheet (External Link)
Vendor Page Anti KLHL33 pAb (ATL-HPA056560) at Atlas Antibodies

Documents & Links for Anti KLHL33 pAb (ATL-HPA056560)
Datasheet Anti KLHL33 pAb (ATL-HPA056560) Datasheet (External Link)
Vendor Page Anti KLHL33 pAb (ATL-HPA056560)