Anti KLHL30 pAb (ATL-HPA062095)

Atlas Antibodies

Catalog No.:
ATL-HPA062095-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kelch-like family member 30
Gene Name: KLHL30
Alternative Gene Name: FLJ43374
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026308: 90%, ENSRNOG00000020105: 89%
Entrez Gene ID: 377007
Uniprot ID: Q0D2K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEVESYDPYTDSWTPVSPALKYVSNFSAAGCRGRLYLVGSSACKYNALALQCYNPVTDAWSVIASPFLPKYL
Gene Sequence VEVESYDPYTDSWTPVSPALKYVSNFSAAGCRGRLYLVGSSACKYNALALQCYNPVTDAWSVIASPFLPKYL
Gene ID - Mouse ENSMUSG00000026308
Gene ID - Rat ENSRNOG00000020105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLHL30 pAb (ATL-HPA062095)
Datasheet Anti KLHL30 pAb (ATL-HPA062095) Datasheet (External Link)
Vendor Page Anti KLHL30 pAb (ATL-HPA062095) at Atlas Antibodies

Documents & Links for Anti KLHL30 pAb (ATL-HPA062095)
Datasheet Anti KLHL30 pAb (ATL-HPA062095) Datasheet (External Link)
Vendor Page Anti KLHL30 pAb (ATL-HPA062095)