Anti KLHL3 pAb (ATL-HPA051291)

Atlas Antibodies

Catalog No.:
ATL-HPA051291-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kelch-like family member 3
Gene Name: KLHL3
Alternative Gene Name: KIAA1129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014164: 69%, ENSRNOG00000019533: 63%
Entrez Gene ID: 26249
Uniprot ID: Q9UH77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEGESVKLSSQTLIQAGDDEKNQRTITVNPAH
Gene Sequence MEGESVKLSSQTLIQAGDDEKNQRTITVNPAH
Gene ID - Mouse ENSMUSG00000014164
Gene ID - Rat ENSRNOG00000019533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLHL3 pAb (ATL-HPA051291)
Datasheet Anti KLHL3 pAb (ATL-HPA051291) Datasheet (External Link)
Vendor Page Anti KLHL3 pAb (ATL-HPA051291) at Atlas Antibodies

Documents & Links for Anti KLHL3 pAb (ATL-HPA051291)
Datasheet Anti KLHL3 pAb (ATL-HPA051291) Datasheet (External Link)
Vendor Page Anti KLHL3 pAb (ATL-HPA051291)
Citations for Anti KLHL3 pAb (ATL-HPA051291) – 1 Found
Schumacher, Frances-Rose; Siew, Keith; Zhang, Jinwei; Johnson, Clare; Wood, Nicola; Cleary, Sarah E; Al Maskari, Raya S; Ferryman, James T; Hardege, Iris; Yasmin; Figg, Nichola L; Enchev, Radoslav; Knebel, Axel; O'Shaughnessy, Kevin M; Kurz, Thimo. Characterisation of the Cullin-3 mutation that causes a severe form of familial hypertension and hyperkalaemia. Embo Molecular Medicine. 2015;7(10):1285-306.  PubMed