Anti KLHL3 pAb (ATL-HPA051291)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051291-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KLHL3
Alternative Gene Name: KIAA1129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014164: 69%, ENSRNOG00000019533: 63%
Entrez Gene ID: 26249
Uniprot ID: Q9UH77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEGESVKLSSQTLIQAGDDEKNQRTITVNPAH |
Gene Sequence | MEGESVKLSSQTLIQAGDDEKNQRTITVNPAH |
Gene ID - Mouse | ENSMUSG00000014164 |
Gene ID - Rat | ENSRNOG00000019533 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KLHL3 pAb (ATL-HPA051291) | |
Datasheet | Anti KLHL3 pAb (ATL-HPA051291) Datasheet (External Link) |
Vendor Page | Anti KLHL3 pAb (ATL-HPA051291) at Atlas Antibodies |
Documents & Links for Anti KLHL3 pAb (ATL-HPA051291) | |
Datasheet | Anti KLHL3 pAb (ATL-HPA051291) Datasheet (External Link) |
Vendor Page | Anti KLHL3 pAb (ATL-HPA051291) |
Citations for Anti KLHL3 pAb (ATL-HPA051291) – 1 Found |
Schumacher, Frances-Rose; Siew, Keith; Zhang, Jinwei; Johnson, Clare; Wood, Nicola; Cleary, Sarah E; Al Maskari, Raya S; Ferryman, James T; Hardege, Iris; Yasmin; Figg, Nichola L; Enchev, Radoslav; Knebel, Axel; O'Shaughnessy, Kevin M; Kurz, Thimo. Characterisation of the Cullin-3 mutation that causes a severe form of familial hypertension and hyperkalaemia. Embo Molecular Medicine. 2015;7(10):1285-306. PubMed |