Anti KLF8 pAb (ATL-HPA071740)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071740-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KLF8
Alternative Gene Name: BKLF3, DXS741, ZNF741
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041649: 90%, ENSRNOG00000039057: 90%
Entrez Gene ID: 11279
Uniprot ID: O95600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ |
Gene Sequence | PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ |
Gene ID - Mouse | ENSMUSG00000041649 |
Gene ID - Rat | ENSRNOG00000039057 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KLF8 pAb (ATL-HPA071740) | |
Datasheet | Anti KLF8 pAb (ATL-HPA071740) Datasheet (External Link) |
Vendor Page | Anti KLF8 pAb (ATL-HPA071740) at Atlas Antibodies |
Documents & Links for Anti KLF8 pAb (ATL-HPA071740) | |
Datasheet | Anti KLF8 pAb (ATL-HPA071740) Datasheet (External Link) |
Vendor Page | Anti KLF8 pAb (ATL-HPA071740) |