Anti KLF8 pAb (ATL-HPA071740)

Atlas Antibodies

Catalog No.: ATL-HPA071740-25

Protein Description: Kruppel-like factor 8
Gene Name: KLF8
Alternative Gene Name: BKLF3, DXS741, ZNF741
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041649: 90%, ENSRNOG00000039057: 90%
Entrez Gene ID: 11279
Uniprot ID: O95600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ
• Gene Sequence: PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ
• Gene ID - Mouse: ENSMUSG00000041649
• Gene ID - Rat: ENSRNOG00000039057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.