Anti KLF8 pAb (ATL-HPA071740)

Atlas Antibodies

Catalog No.:
ATL-HPA071740-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Kruppel-like factor 8
Gene Name: KLF8
Alternative Gene Name: BKLF3, DXS741, ZNF741
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041649: 90%, ENSRNOG00000039057: 90%
Entrez Gene ID: 11279
Uniprot ID: O95600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ
Gene Sequence PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ
Gene ID - Mouse ENSMUSG00000041649
Gene ID - Rat ENSRNOG00000039057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLF8 pAb (ATL-HPA071740)
Datasheet Anti KLF8 pAb (ATL-HPA071740) Datasheet (External Link)
Vendor Page Anti KLF8 pAb (ATL-HPA071740) at Atlas Antibodies

Documents & Links for Anti KLF8 pAb (ATL-HPA071740)
Datasheet Anti KLF8 pAb (ATL-HPA071740) Datasheet (External Link)
Vendor Page Anti KLF8 pAb (ATL-HPA071740)