Anti KLF3 pAb (ATL-HPA065054)

Atlas Antibodies

Catalog No.:
ATL-HPA065054-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Kruppel-like factor 3 (basic)
Gene Name: KLF3
Alternative Gene Name: BKLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029178: 92%, ENSRNOG00000002163: 94%
Entrez Gene ID: 51274
Uniprot ID: P57682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDL
Gene Sequence LMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDL
Gene ID - Mouse ENSMUSG00000029178
Gene ID - Rat ENSRNOG00000002163
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KLF3 pAb (ATL-HPA065054)
Datasheet Anti KLF3 pAb (ATL-HPA065054) Datasheet (External Link)
Vendor Page Anti KLF3 pAb (ATL-HPA065054) at Atlas Antibodies

Documents & Links for Anti KLF3 pAb (ATL-HPA065054)
Datasheet Anti KLF3 pAb (ATL-HPA065054) Datasheet (External Link)
Vendor Page Anti KLF3 pAb (ATL-HPA065054)