Anti KLF12 pAb (ATL-HPA075652)

Atlas Antibodies

SKU: ATL-HPA075652-25

• 

Protein Description: Kruppel like factor 12
Gene Name: KLF12
Alternative Gene Name: AP-2rep, AP2REP, HSPC122
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072294: 99%, ENSRNOG00000009145: 98%
Entrez Gene ID: 11278
Uniprot ID: Q9Y4X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSPTVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAVRSPGNV
• Gene Sequence: SSPTVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAVRSPGNV
• Gene ID - Mouse: ENSMUSG00000072294
• Gene ID - Rat: ENSRNOG00000009145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.