Anti KLF12 pAb (ATL-HPA064146)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064146-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KLF12
Alternative Gene Name: AP-2rep, AP2REP, HSPC122
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072294: 92%, ENSRNOG00000009145: 92%
Entrez Gene ID: 11278
Uniprot ID: Q9Y4X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSIN |
| Gene Sequence | IKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSIN |
| Gene ID - Mouse | ENSMUSG00000072294 |
| Gene ID - Rat | ENSRNOG00000009145 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KLF12 pAb (ATL-HPA064146) | |
| Datasheet | Anti KLF12 pAb (ATL-HPA064146) Datasheet (External Link) |
| Vendor Page | Anti KLF12 pAb (ATL-HPA064146) at Atlas Antibodies |
| Documents & Links for Anti KLF12 pAb (ATL-HPA064146) | |
| Datasheet | Anti KLF12 pAb (ATL-HPA064146) Datasheet (External Link) |
| Vendor Page | Anti KLF12 pAb (ATL-HPA064146) |