Anti KITLG pAb (ATL-HPA070395)

Atlas Antibodies

Catalog No.:
ATL-HPA070395-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: KIT ligand
Gene Name: KITLG
Alternative Gene Name: FPH2, Kitl, KL-1, MGF, SCF, SF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019966: 90%, ENSRNOG00000005386: 90%
Entrez Gene ID: 4254
Uniprot ID: P21583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YWKKRQPSLTRAVENIQINEEDNEISMLQEK
Gene Sequence YWKKRQPSLTRAVENIQINEEDNEISMLQEK
Gene ID - Mouse ENSMUSG00000019966
Gene ID - Rat ENSRNOG00000005386
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KITLG pAb (ATL-HPA070395)
Datasheet Anti KITLG pAb (ATL-HPA070395) Datasheet (External Link)
Vendor Page Anti KITLG pAb (ATL-HPA070395) at Atlas Antibodies

Documents & Links for Anti KITLG pAb (ATL-HPA070395)
Datasheet Anti KITLG pAb (ATL-HPA070395) Datasheet (External Link)
Vendor Page Anti KITLG pAb (ATL-HPA070395)