Anti KITLG pAb (ATL-HPA070395)

Atlas Antibodies

Catalog No.: ATL-HPA070395-25

Protein Description: KIT ligand
Gene Name: KITLG
Alternative Gene Name: FPH2, Kitl, KL-1, MGF, SCF, SF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019966: 90%, ENSRNOG00000005386: 90%
Entrez Gene ID: 4254
Uniprot ID: P21583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YWKKRQPSLTRAVENIQINEEDNEISMLQEK
• Gene Sequence: YWKKRQPSLTRAVENIQINEEDNEISMLQEK
• Gene ID - Mouse: ENSMUSG00000019966
• Gene ID - Rat: ENSRNOG00000005386
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.