Anti KIT pAb (ATL-HPA073252)

Atlas Antibodies

Catalog No.:
ATL-HPA073252-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Gene Name: KIT
Alternative Gene Name: C-Kit, CD117, PBT, SCFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005672: 88%, ENSRNOG00000002227: 89%
Entrez Gene ID: 3815
Uniprot ID: P10721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL
Gene Sequence RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL
Gene ID - Mouse ENSMUSG00000005672
Gene ID - Rat ENSRNOG00000002227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIT pAb (ATL-HPA073252)
Datasheet Anti KIT pAb (ATL-HPA073252) Datasheet (External Link)
Vendor Page Anti KIT pAb (ATL-HPA073252) at Atlas Antibodies

Documents & Links for Anti KIT pAb (ATL-HPA073252)
Datasheet Anti KIT pAb (ATL-HPA073252) Datasheet (External Link)
Vendor Page Anti KIT pAb (ATL-HPA073252)