Anti KIT pAb (ATL-HPA073252)

Atlas Antibodies

SKU: ATL-HPA073252-25

• 

Protein Description: v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Gene Name: KIT
Alternative Gene Name: C-Kit, CD117, PBT, SCFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005672: 88%, ENSRNOG00000002227: 89%
Entrez Gene ID: 3815
Uniprot ID: P10721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL
• Gene Sequence: RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL
• Gene ID - Mouse: ENSMUSG00000005672
• Gene ID - Rat: ENSRNOG00000002227
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.