Anti KIRREL3 pAb (ATL-HPA056320 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056320-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-KIRREL3 antibody. Corresponding KIRREL3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kin of IRRE like 3 (Drosophila)
Gene Name: KIRREL3
Alternative Gene Name: KIAA1867, KIRRE, NEPH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032036: 100%, ENSRNOG00000009772: 100%
Entrez Gene ID: 84623
Uniprot ID: Q8IZU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSR
Gene Sequence PTGMSFTNIYSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSR
Gene ID - Mouse ENSMUSG00000032036
Gene ID - Rat ENSRNOG00000009772
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti KIRREL3 pAb (ATL-HPA056320 w/enhanced validation)
Datasheet Anti KIRREL3 pAb (ATL-HPA056320 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KIRREL3 pAb (ATL-HPA056320 w/enhanced validation)