Anti KIFC3 pAb (ATL-HPA021240)

Atlas Antibodies

Catalog No.:
ATL-HPA021240-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: kinesin family member C3
Gene Name: KIFC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031788: 97%, ENSRNOG00000014087: 97%
Entrez Gene ID: 3801
Uniprot ID: Q9BVG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQT
Gene Sequence NIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQT
Gene ID - Mouse ENSMUSG00000031788
Gene ID - Rat ENSRNOG00000014087
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIFC3 pAb (ATL-HPA021240)
Datasheet Anti KIFC3 pAb (ATL-HPA021240) Datasheet (External Link)
Vendor Page Anti KIFC3 pAb (ATL-HPA021240) at Atlas Antibodies

Documents & Links for Anti KIFC3 pAb (ATL-HPA021240)
Datasheet Anti KIFC3 pAb (ATL-HPA021240) Datasheet (External Link)
Vendor Page Anti KIFC3 pAb (ATL-HPA021240)
Citations for Anti KIFC3 pAb (ATL-HPA021240) – 1 Found
Yost, Kathryn E; Clatterbuck Soper, Sarah F; Walker, Robert L; Pineda, Marbin A; Zhu, Yuelin J; Ester, Corbin D; Showman, Soyeon; Roschke, Anna V; Waterfall, Joshua J; Meltzer, Paul S. Rapid and reversible suppression of ALT by DAXX in osteosarcoma cells. Scientific Reports. 2019;9(1):4544.  PubMed