Anti KIFC3 pAb (ATL-HPA021240)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021240-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KIFC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031788: 97%, ENSRNOG00000014087: 97%
Entrez Gene ID: 3801
Uniprot ID: Q9BVG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQT |
| Gene Sequence | NIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQT |
| Gene ID - Mouse | ENSMUSG00000031788 |
| Gene ID - Rat | ENSRNOG00000014087 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KIFC3 pAb (ATL-HPA021240) | |
| Datasheet | Anti KIFC3 pAb (ATL-HPA021240) Datasheet (External Link) |
| Vendor Page | Anti KIFC3 pAb (ATL-HPA021240) at Atlas Antibodies |
| Documents & Links for Anti KIFC3 pAb (ATL-HPA021240) | |
| Datasheet | Anti KIFC3 pAb (ATL-HPA021240) Datasheet (External Link) |
| Vendor Page | Anti KIFC3 pAb (ATL-HPA021240) |
| Citations for Anti KIFC3 pAb (ATL-HPA021240) – 1 Found |
| Yost, Kathryn E; Clatterbuck Soper, Sarah F; Walker, Robert L; Pineda, Marbin A; Zhu, Yuelin J; Ester, Corbin D; Showman, Soyeon; Roschke, Anna V; Waterfall, Joshua J; Meltzer, Paul S. Rapid and reversible suppression of ALT by DAXX in osteosarcoma cells. Scientific Reports. 2019;9(1):4544. PubMed |