Anti KIFAP3 pAb (ATL-HPA023742)

Atlas Antibodies

Catalog No.:
ATL-HPA023742-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: kinesin-associated protein 3
Gene Name: KIFAP3
Alternative Gene Name: FLA3, KAP-1, KAP3, SMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026585: 100%, ENSRNOG00000002544: 100%
Entrez Gene ID: 22920
Uniprot ID: Q92845
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKK
Gene Sequence ELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKK
Gene ID - Mouse ENSMUSG00000026585
Gene ID - Rat ENSRNOG00000002544
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIFAP3 pAb (ATL-HPA023742)
Datasheet Anti KIFAP3 pAb (ATL-HPA023742) Datasheet (External Link)
Vendor Page Anti KIFAP3 pAb (ATL-HPA023742) at Atlas Antibodies

Documents & Links for Anti KIFAP3 pAb (ATL-HPA023742)
Datasheet Anti KIFAP3 pAb (ATL-HPA023742) Datasheet (External Link)
Vendor Page Anti KIFAP3 pAb (ATL-HPA023742)