Anti KIFAP3 pAb (ATL-HPA023738)

Atlas Antibodies

Catalog No.: ATL-HPA023738-25

Protein Description: kinesin-associated protein 3
Gene Name: KIFAP3
Alternative Gene Name: FLA3, KAP-1, KAP3, SMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026585: 100%, ENSRNOG00000002544: 95%
Entrez Gene ID: 22920
Uniprot ID: Q92845
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSSKPKDPPPFEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIF
• Gene Sequence: KSSKPKDPPPFEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIF
• Gene ID - Mouse: ENSMUSG00000026585
• Gene ID - Rat: ENSRNOG00000002544
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KIFAP3 pAb (ATL-HPA023738) – 1 Found

Telikicherla, Deepthi; Maharudraiah, Jagadeesha; Pawar, Harsh; Marimuthu, Arivusudar; Kashyap, Manoj Kumar; Ramachandra, Y L; Roa, Juan Carlos; Pandey, Akhilesh. Overexpression of Kinesin Associated Protein 3 (KIFAP3) in Breast Cancer. Journal Of Proteomics & Bioinformatics. 2012;5(5):122-126.