Anti KIF6 pAb (ATL-HPA058624)

Atlas Antibodies

Catalog No.:
ATL-HPA058624-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: kinesin family member 6
Gene Name: KIF6
Alternative Gene Name: C6orf102, dJ1043E3.1, dJ137F1.4, dJ188D3.1, DKFZp451I2418, MGC33317
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023999: 84%, ENSRNOG00000011453: 84%
Entrez Gene ID: 221458
Uniprot ID: Q6ZMV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKFQRIFDQDANQETVFENIAKPVAGSVL
Gene Sequence RKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKFQRIFDQDANQETVFENIAKPVAGSVL
Gene ID - Mouse ENSMUSG00000023999
Gene ID - Rat ENSRNOG00000011453
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIF6 pAb (ATL-HPA058624)
Datasheet Anti KIF6 pAb (ATL-HPA058624) Datasheet (External Link)
Vendor Page Anti KIF6 pAb (ATL-HPA058624) at Atlas Antibodies

Documents & Links for Anti KIF6 pAb (ATL-HPA058624)
Datasheet Anti KIF6 pAb (ATL-HPA058624) Datasheet (External Link)
Vendor Page Anti KIF6 pAb (ATL-HPA058624)