Anti KIF5A pAb (ATL-HPA073448)

Atlas Antibodies

Catalog No.:
ATL-HPA073448-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kinesin family member 5A
Gene Name: KIF5A
Alternative Gene Name: D12S1889, MY050, NKHC, SPG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074657: 98%, ENSRNOG00000005299: 100%
Entrez Gene ID: 3798
Uniprot ID: Q12840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT
Gene Sequence RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT
Gene ID - Mouse ENSMUSG00000074657
Gene ID - Rat ENSRNOG00000005299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIF5A pAb (ATL-HPA073448)
Datasheet Anti KIF5A pAb (ATL-HPA073448) Datasheet (External Link)
Vendor Page Anti KIF5A pAb (ATL-HPA073448) at Atlas Antibodies

Documents & Links for Anti KIF5A pAb (ATL-HPA073448)
Datasheet Anti KIF5A pAb (ATL-HPA073448) Datasheet (External Link)
Vendor Page Anti KIF5A pAb (ATL-HPA073448)