Anti KIF2A pAb (ATL-HPA004716)

Atlas Antibodies

Catalog No.:
ATL-HPA004716-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: kinesin heavy chain member 2A
Gene Name: KIF2A
Alternative Gene Name: HK2, KIF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021693: 92%, ENSRNOG00000014000: 94%
Entrez Gene ID: 3796
Uniprot ID: O00139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQA
Gene Sequence DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQA
Gene ID - Mouse ENSMUSG00000021693
Gene ID - Rat ENSRNOG00000014000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIF2A pAb (ATL-HPA004716)
Datasheet Anti KIF2A pAb (ATL-HPA004716) Datasheet (External Link)
Vendor Page Anti KIF2A pAb (ATL-HPA004716) at Atlas Antibodies

Documents & Links for Anti KIF2A pAb (ATL-HPA004716)
Datasheet Anti KIF2A pAb (ATL-HPA004716) Datasheet (External Link)
Vendor Page Anti KIF2A pAb (ATL-HPA004716)
Citations for Anti KIF2A pAb (ATL-HPA004716) – 3 Found
Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35.  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Fu, Jingyan; Bian, Minglei; Xin, Guangwei; Deng, Zhaoxuan; Luo, Jia; Guo, Xiao; Chen, Hao; Wang, Yao; Jiang, Qing; Zhang, Chuanmao. TPX2 phosphorylation maintains metaphase spindle length by regulating microtubule flux. The Journal Of Cell Biology. 2015;210(3):373-83.  PubMed