Anti KIF23 pAb (ATL-HPA068831)

Atlas Antibodies

SKU:
ATL-HPA068831-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: kinesin family member 23
Gene Name: KIF23
Alternative Gene Name: KNSL5, MKLP-1, MKLP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032254: 91%, ENSRNOG00000014080: 82%
Entrez Gene ID: 9493
Uniprot ID: Q02241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL
Gene Sequence APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL
Gene ID - Mouse ENSMUSG00000032254
Gene ID - Rat ENSRNOG00000014080
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KIF23 pAb (ATL-HPA068831)
Datasheet Anti KIF23 pAb (ATL-HPA068831) Datasheet (External Link)
Vendor Page Anti KIF23 pAb (ATL-HPA068831) at Atlas Antibodies

Documents & Links for Anti KIF23 pAb (ATL-HPA068831)
Datasheet Anti KIF23 pAb (ATL-HPA068831) Datasheet (External Link)
Vendor Page Anti KIF23 pAb (ATL-HPA068831)