Anti KIF23 pAb (ATL-HPA068831)

Atlas Antibodies

Catalog No.: ATL-HPA068831-25

Protein Description: kinesin family member 23
Gene Name: KIF23
Alternative Gene Name: KNSL5, MKLP-1, MKLP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032254: 91%, ENSRNOG00000014080: 82%
Entrez Gene ID: 9493
Uniprot ID: Q02241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL
• Gene Sequence: APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL
• Gene ID - Mouse: ENSMUSG00000032254
• Gene ID - Rat: ENSRNOG00000014080
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.