Anti KIF22 pAb (ATL-HPA075670)

Atlas Antibodies

SKU:
ATL-HPA075670-25
  • Immunohistochemical staining of human thymus shows nuclear positivity in a subset of cortical cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kinesin family member 22
Gene Name: KIF22
Alternative Gene Name: Kid, KNSL4, OBP-1, OBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030677: 83%, ENSRNOG00000020281: 81%
Entrez Gene ID: 3835
Uniprot ID: Q14807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
Gene Sequence LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
Gene ID - Mouse ENSMUSG00000030677
Gene ID - Rat ENSRNOG00000020281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KIF22 pAb (ATL-HPA075670)
Datasheet Anti KIF22 pAb (ATL-HPA075670) Datasheet (External Link)
Vendor Page Anti KIF22 pAb (ATL-HPA075670) at Atlas Antibodies

Documents & Links for Anti KIF22 pAb (ATL-HPA075670)
Datasheet Anti KIF22 pAb (ATL-HPA075670) Datasheet (External Link)
Vendor Page Anti KIF22 pAb (ATL-HPA075670)