Anti KIF22 pAb (ATL-HPA075670)

Atlas Antibodies

SKU: ATL-HPA075670-25

• 
• 

Protein Description: kinesin family member 22
Gene Name: KIF22
Alternative Gene Name: Kid, KNSL4, OBP-1, OBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030677: 83%, ENSRNOG00000020281: 81%
Entrez Gene ID: 3835
Uniprot ID: Q14807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
• Gene Sequence: LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF
• Gene ID - Mouse: ENSMUSG00000030677
• Gene ID - Rat: ENSRNOG00000020281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.