Anti KIF21B pAb (ATL-HPA027249)

Atlas Antibodies

Catalog No.: ATL-HPA027249-25

Protein Description: kinesin family member 21B
Gene Name: KIF21B
Alternative Gene Name: DKFZP434J212, KIAA0449
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041642: 91%, ENSRNOG00000008471: 93%
Entrez Gene ID: 23046
Uniprot ID: O75037
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQKKG
• Gene Sequence: RKTQEVSALRRLAKPMSERVAGRAGLKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKKFQKKG
• Gene ID - Mouse: ENSMUSG00000041642
• Gene ID - Rat: ENSRNOG00000008471
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KIF21B pAb (ATL-HPA027249) – 1 Found

Hooikaas, Peter Jan; Damstra, Hugo Gj; Gros, Oane J; van Riel, Wilhelmina E; Martin, Maud; Smits, Yesper Th; van Loosdregt, Jorg; Kapitein, Lukas C; Berger, Florian; Akhmanova, Anna. Kinesin-4 KIF21B limits microtubule growth to allow rapid centrosome polarization in T cells. Elife. 2020;9( 33346730)