Anti KIF21A pAb (ATL-HPA058432 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058432-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KIF21A
Alternative Gene Name: FEOM1, FLJ20052
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022629: 89%, ENSRNOG00000014844: 89%
Entrez Gene ID: 55605
Uniprot ID: Q7Z4S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS |
| Gene Sequence | QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS |
| Gene ID - Mouse | ENSMUSG00000022629 |
| Gene ID - Rat | ENSRNOG00000014844 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KIF21A pAb (ATL-HPA058432 w/enhanced validation) | |
| Datasheet | Anti KIF21A pAb (ATL-HPA058432 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KIF21A pAb (ATL-HPA058432 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti KIF21A pAb (ATL-HPA058432 w/enhanced validation) | |
| Datasheet | Anti KIF21A pAb (ATL-HPA058432 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KIF21A pAb (ATL-HPA058432 w/enhanced validation) |