Anti KIF21A pAb (ATL-HPA058432 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA058432-25

Protein Description: kinesin family member 21A
Gene Name: KIF21A
Alternative Gene Name: FEOM1, FLJ20052
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022629: 89%, ENSRNOG00000014844: 89%
Entrez Gene ID: 55605
Uniprot ID: Q7Z4S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS
• Gene Sequence: QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS
• Gene ID - Mouse: ENSMUSG00000022629
• Gene ID - Rat: ENSRNOG00000014844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.