Anti KIF18B pAb (ATL-HPA024205 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024205-25

Protein Description: kinesin family member 18B
Gene Name: KIF18B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051378: 84%, ENSRNOG00000021713: 82%
Entrez Gene ID: 146909
Uniprot ID: Q86Y91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDGPKKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYN
• Gene Sequence: STLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDGPKKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYN
• Gene ID - Mouse: ENSMUSG00000051378
• Gene ID - Rat: ENSRNOG00000021713
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KIF18B pAb (ATL-HPA024205 w/enhanced validation) – 1 Found

Moreci, Rebecca S; Lechler, Terry. KIF18B is a cell type-specific regulator of spindle orientation in the epidermis. Molecular Biology Of The Cell. 2021;32(21):ar29.