Anti KIF15 pAb (ATL-HPA061469)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061469-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KIF15
Alternative Gene Name: HKLP2, KNSL7, NY-BR-62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036768: 79%, ENSRNOG00000060356: 78%
Entrez Gene ID: 56992
Uniprot ID: Q9NS87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RPVPKLSPEMGSFGSLYTQNSSILDNDILNEPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVD |
Gene Sequence | RPVPKLSPEMGSFGSLYTQNSSILDNDILNEPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVD |
Gene ID - Mouse | ENSMUSG00000036768 |
Gene ID - Rat | ENSRNOG00000060356 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KIF15 pAb (ATL-HPA061469) | |
Datasheet | Anti KIF15 pAb (ATL-HPA061469) Datasheet (External Link) |
Vendor Page | Anti KIF15 pAb (ATL-HPA061469) at Atlas Antibodies |
Documents & Links for Anti KIF15 pAb (ATL-HPA061469) | |
Datasheet | Anti KIF15 pAb (ATL-HPA061469) Datasheet (External Link) |
Vendor Page | Anti KIF15 pAb (ATL-HPA061469) |