Anti KIF15 pAb (ATL-HPA061469)

Atlas Antibodies

SKU: ATL-HPA061469-25

• 
• 

Protein Description: kinesin family member 15
Gene Name: KIF15
Alternative Gene Name: HKLP2, KNSL7, NY-BR-62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036768: 79%, ENSRNOG00000060356: 78%
Entrez Gene ID: 56992
Uniprot ID: Q9NS87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPVPKLSPEMGSFGSLYTQNSSILDNDILNEPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVD
• Gene Sequence: RPVPKLSPEMGSFGSLYTQNSSILDNDILNEPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVD
• Gene ID - Mouse: ENSMUSG00000036768
• Gene ID - Rat: ENSRNOG00000060356
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.