Anti KIAA2013 pAb (ATL-HPA052677)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052677-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KIAA2013
Alternative Gene Name: MGC33867, RP5-1077B9.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030781: 33%, ENSRNOG00000019207: 33%
Entrez Gene ID: 90231
Uniprot ID: Q8IYS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LFRSKVGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQE |
| Gene Sequence | LFRSKVGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQE |
| Gene ID - Mouse | ENSMUSG00000030781 |
| Gene ID - Rat | ENSRNOG00000019207 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KIAA2013 pAb (ATL-HPA052677) | |
| Datasheet | Anti KIAA2013 pAb (ATL-HPA052677) Datasheet (External Link) |
| Vendor Page | Anti KIAA2013 pAb (ATL-HPA052677) at Atlas Antibodies |
| Documents & Links for Anti KIAA2013 pAb (ATL-HPA052677) | |
| Datasheet | Anti KIAA2013 pAb (ATL-HPA052677) Datasheet (External Link) |
| Vendor Page | Anti KIAA2013 pAb (ATL-HPA052677) |