Anti KIAA2013 pAb (ATL-HPA052677)

Atlas Antibodies

Catalog No.:
ATL-HPA052677-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KIAA2013
Gene Name: KIAA2013
Alternative Gene Name: MGC33867, RP5-1077B9.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030781: 33%, ENSRNOG00000019207: 33%
Entrez Gene ID: 90231
Uniprot ID: Q8IYS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFRSKVGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQE
Gene Sequence LFRSKVGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQE
Gene ID - Mouse ENSMUSG00000030781
Gene ID - Rat ENSRNOG00000019207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA2013 pAb (ATL-HPA052677)
Datasheet Anti KIAA2013 pAb (ATL-HPA052677) Datasheet (External Link)
Vendor Page Anti KIAA2013 pAb (ATL-HPA052677) at Atlas Antibodies

Documents & Links for Anti KIAA2013 pAb (ATL-HPA052677)
Datasheet Anti KIAA2013 pAb (ATL-HPA052677) Datasheet (External Link)
Vendor Page Anti KIAA2013 pAb (ATL-HPA052677)