Anti KIAA1755 pAb (ATL-HPA051064)

Atlas Antibodies

Catalog No.:
ATL-HPA051064-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KIAA1755
Gene Name: KIAA1755
Alternative Gene Name: RP5-1054A22.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037813: 80%, ENSRNOG00000014424: 79%
Entrez Gene ID: 85449
Uniprot ID: Q5JYT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDPFLADLHQASSLLQASIEEFEKADPPGGMQEATRCLSKSKELMEAVLRDPGLLGLQREGGATLARLQHDASRLDFSPDV
Gene Sequence LDPFLADLHQASSLLQASIEEFEKADPPGGMQEATRCLSKSKELMEAVLRDPGLLGLQREGGATLARLQHDASRLDFSPDV
Gene ID - Mouse ENSMUSG00000037813
Gene ID - Rat ENSRNOG00000014424
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA1755 pAb (ATL-HPA051064)
Datasheet Anti KIAA1755 pAb (ATL-HPA051064) Datasheet (External Link)
Vendor Page Anti KIAA1755 pAb (ATL-HPA051064) at Atlas Antibodies

Documents & Links for Anti KIAA1755 pAb (ATL-HPA051064)
Datasheet Anti KIAA1755 pAb (ATL-HPA051064) Datasheet (External Link)
Vendor Page Anti KIAA1755 pAb (ATL-HPA051064)