Anti KIAA1755 pAb (ATL-HPA051064)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051064-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KIAA1755
Alternative Gene Name: RP5-1054A22.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037813: 80%, ENSRNOG00000014424: 79%
Entrez Gene ID: 85449
Uniprot ID: Q5JYT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDPFLADLHQASSLLQASIEEFEKADPPGGMQEATRCLSKSKELMEAVLRDPGLLGLQREGGATLARLQHDASRLDFSPDV |
Gene Sequence | LDPFLADLHQASSLLQASIEEFEKADPPGGMQEATRCLSKSKELMEAVLRDPGLLGLQREGGATLARLQHDASRLDFSPDV |
Gene ID - Mouse | ENSMUSG00000037813 |
Gene ID - Rat | ENSRNOG00000014424 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KIAA1755 pAb (ATL-HPA051064) | |
Datasheet | Anti KIAA1755 pAb (ATL-HPA051064) Datasheet (External Link) |
Vendor Page | Anti KIAA1755 pAb (ATL-HPA051064) at Atlas Antibodies |
Documents & Links for Anti KIAA1755 pAb (ATL-HPA051064) | |
Datasheet | Anti KIAA1755 pAb (ATL-HPA051064) Datasheet (External Link) |
Vendor Page | Anti KIAA1755 pAb (ATL-HPA051064) |