Anti KIAA1644 pAb (ATL-HPA051178)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051178-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: KIAA1644
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062760: 98%, ENSRNOG00000052725: 98%
Entrez Gene ID: 85352
Uniprot ID: Q3SXP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CEPYTDHKGRYHFGFHCPRLSDNKTFILCCHHNNTVFKYCCNETEFQAVMQAN |
Gene Sequence | CEPYTDHKGRYHFGFHCPRLSDNKTFILCCHHNNTVFKYCCNETEFQAVMQAN |
Gene ID - Mouse | ENSMUSG00000062760 |
Gene ID - Rat | ENSRNOG00000052725 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KIAA1644 pAb (ATL-HPA051178) | |
Datasheet | Anti KIAA1644 pAb (ATL-HPA051178) Datasheet (External Link) |
Vendor Page | Anti KIAA1644 pAb (ATL-HPA051178) at Atlas Antibodies |
Documents & Links for Anti KIAA1644 pAb (ATL-HPA051178) | |
Datasheet | Anti KIAA1644 pAb (ATL-HPA051178) Datasheet (External Link) |
Vendor Page | Anti KIAA1644 pAb (ATL-HPA051178) |