Anti KIAA1644 pAb (ATL-HPA051178)

Atlas Antibodies

Catalog No.:
ATL-HPA051178-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: KIAA1644
Gene Name: KIAA1644
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062760: 98%, ENSRNOG00000052725: 98%
Entrez Gene ID: 85352
Uniprot ID: Q3SXP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CEPYTDHKGRYHFGFHCPRLSDNKTFILCCHHNNTVFKYCCNETEFQAVMQAN
Gene Sequence CEPYTDHKGRYHFGFHCPRLSDNKTFILCCHHNNTVFKYCCNETEFQAVMQAN
Gene ID - Mouse ENSMUSG00000062760
Gene ID - Rat ENSRNOG00000052725
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA1644 pAb (ATL-HPA051178)
Datasheet Anti KIAA1644 pAb (ATL-HPA051178) Datasheet (External Link)
Vendor Page Anti KIAA1644 pAb (ATL-HPA051178) at Atlas Antibodies

Documents & Links for Anti KIAA1644 pAb (ATL-HPA051178)
Datasheet Anti KIAA1644 pAb (ATL-HPA051178) Datasheet (External Link)
Vendor Page Anti KIAA1644 pAb (ATL-HPA051178)