Anti KIAA1522 pAb (ATL-HPA064839)

Atlas Antibodies

Catalog No.:
ATL-HPA064839-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KIAA1522
Gene Name: KIAA1522
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050390: 83%, ENSRNOG00000008113: 85%
Entrez Gene ID: 57648
Uniprot ID: Q9P206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAKAENDKHLSVGPGQGPGSAVDEHQDNVFFPSGRPPHLEELHTQAQEGLRSLQHQEKQKLNKGGWDHGDTQSIQSSR
Gene Sequence SAKAENDKHLSVGPGQGPGSAVDEHQDNVFFPSGRPPHLEELHTQAQEGLRSLQHQEKQKLNKGGWDHGDTQSIQSSR
Gene ID - Mouse ENSMUSG00000050390
Gene ID - Rat ENSRNOG00000008113
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA1522 pAb (ATL-HPA064839)
Datasheet Anti KIAA1522 pAb (ATL-HPA064839) Datasheet (External Link)
Vendor Page Anti KIAA1522 pAb (ATL-HPA064839) at Atlas Antibodies

Documents & Links for Anti KIAA1522 pAb (ATL-HPA064839)
Datasheet Anti KIAA1522 pAb (ATL-HPA064839) Datasheet (External Link)
Vendor Page Anti KIAA1522 pAb (ATL-HPA064839)