Anti KIAA1211L pAb (ATL-HPA061678)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061678-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: KIAA1211L
Alternative Gene Name: C2orf55, MGC42367
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026090: 81%, ENSRNOG00000018366: 80%
Entrez Gene ID: 343990
Uniprot ID: Q6NV74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTRNEVIAIESGPVGYDSEDELEESR |
Gene Sequence | LREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTRNEVIAIESGPVGYDSEDELEESR |
Gene ID - Mouse | ENSMUSG00000026090 |
Gene ID - Rat | ENSRNOG00000018366 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KIAA1211L pAb (ATL-HPA061678) | |
Datasheet | Anti KIAA1211L pAb (ATL-HPA061678) Datasheet (External Link) |
Vendor Page | Anti KIAA1211L pAb (ATL-HPA061678) at Atlas Antibodies |
Documents & Links for Anti KIAA1211L pAb (ATL-HPA061678) | |
Datasheet | Anti KIAA1211L pAb (ATL-HPA061678) Datasheet (External Link) |
Vendor Page | Anti KIAA1211L pAb (ATL-HPA061678) |