Anti KIAA1211L pAb (ATL-HPA061678)

Atlas Antibodies

Catalog No.:
ATL-HPA061678-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: KIAA1211-like
Gene Name: KIAA1211L
Alternative Gene Name: C2orf55, MGC42367
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026090: 81%, ENSRNOG00000018366: 80%
Entrez Gene ID: 343990
Uniprot ID: Q6NV74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTRNEVIAIESGPVGYDSEDELEESR
Gene Sequence LREAAEGLGEDSTGKKKSKFKTFKKFFGKKKRKESPSSTGSSTWKQSQTRNEVIAIESGPVGYDSEDELEESR
Gene ID - Mouse ENSMUSG00000026090
Gene ID - Rat ENSRNOG00000018366
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA1211L pAb (ATL-HPA061678)
Datasheet Anti KIAA1211L pAb (ATL-HPA061678) Datasheet (External Link)
Vendor Page Anti KIAA1211L pAb (ATL-HPA061678) at Atlas Antibodies

Documents & Links for Anti KIAA1211L pAb (ATL-HPA061678)
Datasheet Anti KIAA1211L pAb (ATL-HPA061678) Datasheet (External Link)
Vendor Page Anti KIAA1211L pAb (ATL-HPA061678)