Anti KIAA1161 pAb (ATL-HPA060533)

Atlas Antibodies

Catalog No.:
ATL-HPA060533-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: KIAA1161
Gene Name: KIAA1161
Alternative Gene Name: NET37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046312: 98%, ENSRNOG00000023208: 99%
Entrez Gene ID: 57462
Uniprot ID: Q6NSJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGDTLLVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEI
Gene Sequence GEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGDTLLVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEI
Gene ID - Mouse ENSMUSG00000046312
Gene ID - Rat ENSRNOG00000023208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA1161 pAb (ATL-HPA060533)
Datasheet Anti KIAA1161 pAb (ATL-HPA060533) Datasheet (External Link)
Vendor Page Anti KIAA1161 pAb (ATL-HPA060533) at Atlas Antibodies

Documents & Links for Anti KIAA1161 pAb (ATL-HPA060533)
Datasheet Anti KIAA1161 pAb (ATL-HPA060533) Datasheet (External Link)
Vendor Page Anti KIAA1161 pAb (ATL-HPA060533)