Anti KIAA1147 pAb (ATL-HPA061437)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061437-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KIAA1147
Alternative Gene Name: LCHN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037172: 100%, ENSRNOG00000011854: 99%
Entrez Gene ID: 57189
Uniprot ID: A4D1U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPLLKINSADREKYRRLNEQRQMLL |
| Gene Sequence | FYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPLLKINSADREKYRRLNEQRQMLL |
| Gene ID - Mouse | ENSMUSG00000037172 |
| Gene ID - Rat | ENSRNOG00000011854 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KIAA1147 pAb (ATL-HPA061437) | |
| Datasheet | Anti KIAA1147 pAb (ATL-HPA061437) Datasheet (External Link) |
| Vendor Page | Anti KIAA1147 pAb (ATL-HPA061437) at Atlas Antibodies |
| Documents & Links for Anti KIAA1147 pAb (ATL-HPA061437) | |
| Datasheet | Anti KIAA1147 pAb (ATL-HPA061437) Datasheet (External Link) |
| Vendor Page | Anti KIAA1147 pAb (ATL-HPA061437) |