Anti KIAA1147 pAb (ATL-HPA061437)

Atlas Antibodies

Catalog No.:
ATL-HPA061437-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KIAA1147
Gene Name: KIAA1147
Alternative Gene Name: LCHN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037172: 100%, ENSRNOG00000011854: 99%
Entrez Gene ID: 57189
Uniprot ID: A4D1U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPLLKINSADREKYRRLNEQRQMLL
Gene Sequence FYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPLLKINSADREKYRRLNEQRQMLL
Gene ID - Mouse ENSMUSG00000037172
Gene ID - Rat ENSRNOG00000011854
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA1147 pAb (ATL-HPA061437)
Datasheet Anti KIAA1147 pAb (ATL-HPA061437) Datasheet (External Link)
Vendor Page Anti KIAA1147 pAb (ATL-HPA061437) at Atlas Antibodies

Documents & Links for Anti KIAA1147 pAb (ATL-HPA061437)
Datasheet Anti KIAA1147 pAb (ATL-HPA061437) Datasheet (External Link)
Vendor Page Anti KIAA1147 pAb (ATL-HPA061437)