Anti KIAA0232 pAb (ATL-HPA061498)

Atlas Antibodies

Catalog No.:
ATL-HPA061498-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KIAA0232
Gene Name: KIAA0232
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029190: 94%, ENSRNOG00000027623: 94%
Entrez Gene ID: 9778
Uniprot ID: Q92628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESVHGLCISNNNLHKTYLAAGTFIDGHFVEMPAVINEDIDLTGTSLCSLPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMI
Gene Sequence ESVHGLCISNNNLHKTYLAAGTFIDGHFVEMPAVINEDIDLTGTSLCSLPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMI
Gene ID - Mouse ENSMUSG00000029190
Gene ID - Rat ENSRNOG00000027623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA0232 pAb (ATL-HPA061498)
Datasheet Anti KIAA0232 pAb (ATL-HPA061498) Datasheet (External Link)
Vendor Page Anti KIAA0232 pAb (ATL-HPA061498) at Atlas Antibodies

Documents & Links for Anti KIAA0232 pAb (ATL-HPA061498)
Datasheet Anti KIAA0232 pAb (ATL-HPA061498) Datasheet (External Link)
Vendor Page Anti KIAA0232 pAb (ATL-HPA061498)