Anti KHSRP pAb (ATL-HPA056518)

Atlas Antibodies

SKU: ATL-HPA056518-25

• 

Protein Description: KH-type splicing regulatory protein
Gene Name: KHSRP
Alternative Gene Name: FBP2, FUBP2, KSRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007670: 98%, ENSRNOG00000047628: 98%
Entrez Gene ID: 8570
Uniprot ID: Q92945
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAA
• Gene Sequence: PFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAA
• Gene ID - Mouse: ENSMUSG00000007670
• Gene ID - Rat: ENSRNOG00000047628
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.