Anti KHDRBS3 pAb (ATL-HPA000275 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000275-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KHDRBS3
Alternative Gene Name: Etle, etoile, SALP, SLM-2, SLM2, T-STAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022332: 95%, ENSRNOG00000009539: 93%
Entrez Gene ID: 10656
Uniprot ID: O75525
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS |
| Gene Sequence | ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS |
| Gene ID - Mouse | ENSMUSG00000022332 |
| Gene ID - Rat | ENSRNOG00000009539 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KHDRBS3 pAb (ATL-HPA000275 w/enhanced validation) | |
| Datasheet | Anti KHDRBS3 pAb (ATL-HPA000275 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KHDRBS3 pAb (ATL-HPA000275 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti KHDRBS3 pAb (ATL-HPA000275 w/enhanced validation) | |
| Datasheet | Anti KHDRBS3 pAb (ATL-HPA000275 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KHDRBS3 pAb (ATL-HPA000275 w/enhanced validation) |
| Citations for Anti KHDRBS3 pAb (ATL-HPA000275 w/enhanced validation) – 2 Found |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Luxton, Hayley J; Simpson, Benjamin S; Mills, Ian G; Brindle, Nicola R; Ahmed, Zeba; Stavrinides, Vasilis; Heavey, Susan; Stamm, Stefan; Whitaker, Hayley C. The Oncogene Metadherin Interacts with the Known Splicing Proteins YTHDC1, Sam68 and T-STAR and Plays a Novel Role in Alternative mRNA Splicing. Cancers. 2019;11(9) PubMed |