Anti KHDRBS1 pAb (ATL-HPA051280 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051280-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: KHDRBS1
Alternative Gene Name: FLJ34027, p62, Sam68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028790: 97%, ENSRNOG00000046794: 95%
Entrez Gene ID: 10657
Uniprot ID: Q07666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYR |
| Gene Sequence | YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYR |
| Gene ID - Mouse | ENSMUSG00000028790 |
| Gene ID - Rat | ENSRNOG00000046794 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KHDRBS1 pAb (ATL-HPA051280 w/enhanced validation) | |
| Datasheet | Anti KHDRBS1 pAb (ATL-HPA051280 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KHDRBS1 pAb (ATL-HPA051280 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti KHDRBS1 pAb (ATL-HPA051280 w/enhanced validation) | |
| Datasheet | Anti KHDRBS1 pAb (ATL-HPA051280 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KHDRBS1 pAb (ATL-HPA051280 w/enhanced validation) |