Anti KHDC1 pAb (ATL-HPA029032)

Atlas Antibodies

Catalog No.:
ATL-HPA029032-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KH homology domain containing 1
Gene Name: KHDC1
Alternative Gene Name: bA257K9.4, C6orf147, C6orf148, Em:AC019205.8, MGC10818, NDG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085079: 33%, ENSRNOG00000052878: 38%
Entrez Gene ID: 80759
Uniprot ID: Q4VXA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RERNSRSGKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGD
Gene Sequence RERNSRSGKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGD
Gene ID - Mouse ENSMUSG00000085079
Gene ID - Rat ENSRNOG00000052878
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KHDC1 pAb (ATL-HPA029032)
Datasheet Anti KHDC1 pAb (ATL-HPA029032) Datasheet (External Link)
Vendor Page Anti KHDC1 pAb (ATL-HPA029032) at Atlas Antibodies

Documents & Links for Anti KHDC1 pAb (ATL-HPA029032)
Datasheet Anti KHDC1 pAb (ATL-HPA029032) Datasheet (External Link)
Vendor Page Anti KHDC1 pAb (ATL-HPA029032)