Anti KDM7A pAb (ATL-HPA012114)

Atlas Antibodies

Catalog No.: ATL-HPA012114-25

Protein Description: lysine (K)-specific demethylase 7A
Gene Name: KDM7A
Alternative Gene Name: JHDM1D, KIAA1718
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042599: 96%, ENSRNOG00000052445: 92%
Entrez Gene ID: 80853
Uniprot ID: Q6ZMT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGIPIVCPVSRSSNEA
• Gene Sequence: LETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGIPIVCPVSRSSNEA
• Gene ID - Mouse: ENSMUSG00000042599
• Gene ID - Rat: ENSRNOG00000052445
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.