Anti KDM6A pAb (ATL-HPA001165)

Atlas Antibodies

Catalog No.: ATL-HPA001165-25

Protein Description: lysine (K)-specific demethylase 6A
Gene Name: KDM6A
Alternative Gene Name: UTX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037369: 97%, ENSRNOG00000052721: 97%
Entrez Gene ID: 7403
Uniprot ID: O15550
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTI
• Gene Sequence: SNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTI
• Gene ID - Mouse: ENSMUSG00000037369
• Gene ID - Rat: ENSRNOG00000052721
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KDM6A pAb (ATL-HPA001165) – 1 Found

Mir, Shahryar E; Smits, Michiel; Biesmans, Dennis; Julsing, Machteld; Bugiani, Marianna; Aronica, Eleonora; Kaspers, Gertjan J L; Cloos, Jacqueline; Würdinger, Thomas; Hulleman, Esther. Trimethylation of H3K27 during human cerebellar development in relation to medulloblastoma. Oncotarget. 2017;8(45):78978-78988.