Anti KDM4E pAb (ATL-HPA054225)

Atlas Antibodies

Catalog No.:
ATL-HPA054225-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lysine (K)-specific demethylase 4E
Gene Name: KDM4E
Alternative Gene Name: JMJD2E, KDM4DL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025314: 31%, ENSRNOG00000060802: 35%
Entrez Gene ID: 390245
Uniprot ID: B2RXH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLLMGTRSRAQGHRPQLPLANDLMTNLS
Gene Sequence GQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLLMGTRSRAQGHRPQLPLANDLMTNLS
Gene ID - Mouse ENSMUSG00000025314
Gene ID - Rat ENSRNOG00000060802
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KDM4E pAb (ATL-HPA054225)
Datasheet Anti KDM4E pAb (ATL-HPA054225) Datasheet (External Link)
Vendor Page Anti KDM4E pAb (ATL-HPA054225) at Atlas Antibodies

Documents & Links for Anti KDM4E pAb (ATL-HPA054225)
Datasheet Anti KDM4E pAb (ATL-HPA054225) Datasheet (External Link)
Vendor Page Anti KDM4E pAb (ATL-HPA054225)