Anti KDM4B pAb (ATL-HPA062872)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062872-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KDM4B
Alternative Gene Name: JMJD2B, KIAA0876, TDRD14B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024201: 70%, ENSRNOG00000049221: 74%
Entrez Gene ID: 23030
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG |
| Gene Sequence | SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG |
| Gene ID - Mouse | ENSMUSG00000024201 |
| Gene ID - Rat | ENSRNOG00000049221 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KDM4B pAb (ATL-HPA062872) | |
| Datasheet | Anti KDM4B pAb (ATL-HPA062872) Datasheet (External Link) |
| Vendor Page | Anti KDM4B pAb (ATL-HPA062872) at Atlas Antibodies |
| Documents & Links for Anti KDM4B pAb (ATL-HPA062872) | |
| Datasheet | Anti KDM4B pAb (ATL-HPA062872) Datasheet (External Link) |
| Vendor Page | Anti KDM4B pAb (ATL-HPA062872) |