Anti KDM4B pAb (ATL-HPA062872)

Atlas Antibodies

Catalog No.:
ATL-HPA062872-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lysine (K)-specific demethylase 4B
Gene Name: KDM4B
Alternative Gene Name: JMJD2B, KIAA0876, TDRD14B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024201: 70%, ENSRNOG00000049221: 74%
Entrez Gene ID: 23030
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG
Gene Sequence SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG
Gene ID - Mouse ENSMUSG00000024201
Gene ID - Rat ENSRNOG00000049221
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KDM4B pAb (ATL-HPA062872)
Datasheet Anti KDM4B pAb (ATL-HPA062872) Datasheet (External Link)
Vendor Page Anti KDM4B pAb (ATL-HPA062872) at Atlas Antibodies

Documents & Links for Anti KDM4B pAb (ATL-HPA062872)
Datasheet Anti KDM4B pAb (ATL-HPA062872) Datasheet (External Link)
Vendor Page Anti KDM4B pAb (ATL-HPA062872)