Anti KDM3B pAb (ATL-HPA057202)

Atlas Antibodies

Catalog No.:
ATL-HPA057202-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: lysine (K)-specific demethylase 3B
Gene Name: KDM3B
Alternative Gene Name: C5orf7, JMJD1B, KIAA1082, NET22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038773: 93%, ENSRNOG00000050200: 93%
Entrez Gene ID: 51780
Uniprot ID: Q7LBC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST
Gene Sequence TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST
Gene ID - Mouse ENSMUSG00000038773
Gene ID - Rat ENSRNOG00000050200
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KDM3B pAb (ATL-HPA057202)
Datasheet Anti KDM3B pAb (ATL-HPA057202) Datasheet (External Link)
Vendor Page Anti KDM3B pAb (ATL-HPA057202) at Atlas Antibodies

Documents & Links for Anti KDM3B pAb (ATL-HPA057202)
Datasheet Anti KDM3B pAb (ATL-HPA057202) Datasheet (External Link)
Vendor Page Anti KDM3B pAb (ATL-HPA057202)