Anti KDELC2 pAb (ATL-HPA066134)

Atlas Antibodies

Catalog No.:
ATL-HPA066134-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: KDEL (Lys-Asp-Glu-Leu) containing 2
Gene Name: KDELC2
Alternative Gene Name: MGC33424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034487: 83%, ENSRNOG00000007177: 81%
Entrez Gene ID: 143888
Uniprot ID: Q7Z4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPEDSTAICQCHRK
Gene Sequence KEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPEDSTAICQCHRK
Gene ID - Mouse ENSMUSG00000034487
Gene ID - Rat ENSRNOG00000007177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KDELC2 pAb (ATL-HPA066134)
Datasheet Anti KDELC2 pAb (ATL-HPA066134) Datasheet (External Link)
Vendor Page Anti KDELC2 pAb (ATL-HPA066134) at Atlas Antibodies

Documents & Links for Anti KDELC2 pAb (ATL-HPA066134)
Datasheet Anti KDELC2 pAb (ATL-HPA066134) Datasheet (External Link)
Vendor Page Anti KDELC2 pAb (ATL-HPA066134)