Anti KCTD18 pAb (ATL-HPA058028)

Atlas Antibodies

Catalog No.:
ATL-HPA058028-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium channel tetramerization domain containing 18
Gene Name: KCTD18
Alternative Gene Name: 6530404F10Rik, FLJ31322, FLJ37818
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054770: 99%, ENSRNOG00000027091: 97%
Entrez Gene ID: 130535
Uniprot ID: Q6PI47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKTDGTDAIEK
Gene Sequence YPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKTDGTDAIEK
Gene ID - Mouse ENSMUSG00000054770
Gene ID - Rat ENSRNOG00000027091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCTD18 pAb (ATL-HPA058028)
Datasheet Anti KCTD18 pAb (ATL-HPA058028) Datasheet (External Link)
Vendor Page Anti KCTD18 pAb (ATL-HPA058028) at Atlas Antibodies

Documents & Links for Anti KCTD18 pAb (ATL-HPA058028)
Datasheet Anti KCTD18 pAb (ATL-HPA058028) Datasheet (External Link)
Vendor Page Anti KCTD18 pAb (ATL-HPA058028)