Anti KCTD15 pAb (ATL-HPA050822)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050822-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KCTD15
Alternative Gene Name: MGC25497
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030499: 93%, ENSRNOG00000021137: 93%
Entrez Gene ID: 79047
Uniprot ID: Q96SI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGI |
Gene Sequence | MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGI |
Gene ID - Mouse | ENSMUSG00000030499 |
Gene ID - Rat | ENSRNOG00000021137 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KCTD15 pAb (ATL-HPA050822) | |
Datasheet | Anti KCTD15 pAb (ATL-HPA050822) Datasheet (External Link) |
Vendor Page | Anti KCTD15 pAb (ATL-HPA050822) at Atlas Antibodies |
Documents & Links for Anti KCTD15 pAb (ATL-HPA050822) | |
Datasheet | Anti KCTD15 pAb (ATL-HPA050822) Datasheet (External Link) |
Vendor Page | Anti KCTD15 pAb (ATL-HPA050822) |