Anti KCTD15 pAb (ATL-HPA050822)

Atlas Antibodies

SKU: ATL-HPA050822-25

• 
• 
• 

Protein Description: potassium channel tetramerization domain containing 15
Gene Name: KCTD15
Alternative Gene Name: MGC25497
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030499: 93%, ENSRNOG00000021137: 93%
Entrez Gene ID: 79047
Uniprot ID: Q96SI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGI
• Gene Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGI
• Gene ID - Mouse: ENSMUSG00000030499
• Gene ID - Rat: ENSRNOG00000021137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.