Anti KCTD11 pAb (ATL-HPA052035)

Atlas Antibodies

Catalog No.:
ATL-HPA052035-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium channel tetramerization domain containing 11
Gene Name: KCTD11
Alternative Gene Name: C17orf36, KCASH1, REN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046731: 89%, ENSRNOG00000015669: 92%
Entrez Gene ID: 147040
Uniprot ID: Q693B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVAS
Gene Sequence DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVAS
Gene ID - Mouse ENSMUSG00000046731
Gene ID - Rat ENSRNOG00000015669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCTD11 pAb (ATL-HPA052035)
Datasheet Anti KCTD11 pAb (ATL-HPA052035) Datasheet (External Link)
Vendor Page Anti KCTD11 pAb (ATL-HPA052035) at Atlas Antibodies

Documents & Links for Anti KCTD11 pAb (ATL-HPA052035)
Datasheet Anti KCTD11 pAb (ATL-HPA052035) Datasheet (External Link)
Vendor Page Anti KCTD11 pAb (ATL-HPA052035)