Anti KCTD11 pAb (ATL-HPA052035)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052035-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KCTD11
Alternative Gene Name: C17orf36, KCASH1, REN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046731: 89%, ENSRNOG00000015669: 92%
Entrez Gene ID: 147040
Uniprot ID: Q693B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVAS |
| Gene Sequence | DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVAS |
| Gene ID - Mouse | ENSMUSG00000046731 |
| Gene ID - Rat | ENSRNOG00000015669 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCTD11 pAb (ATL-HPA052035) | |
| Datasheet | Anti KCTD11 pAb (ATL-HPA052035) Datasheet (External Link) |
| Vendor Page | Anti KCTD11 pAb (ATL-HPA052035) at Atlas Antibodies |
| Documents & Links for Anti KCTD11 pAb (ATL-HPA052035) | |
| Datasheet | Anti KCTD11 pAb (ATL-HPA052035) Datasheet (External Link) |
| Vendor Page | Anti KCTD11 pAb (ATL-HPA052035) |