Anti KCNS3 pAb (ATL-HPA014864)

Atlas Antibodies

Catalog No.: ATL-HPA014864-25

Protein Description: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3
Gene Name: KCNS3
Alternative Gene Name: Kv9.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043673: 84%, ENSRNOG00000004899: 86%
Entrez Gene ID: 3790
Uniprot ID: Q9BQ31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA
• Gene Sequence: KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA
• Gene ID - Mouse: ENSMUSG00000043673
• Gene ID - Rat: ENSRNOG00000004899
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCNS3 pAb (ATL-HPA014864) – 1 Found

Fu, L C; Lv, Y; Zhong, Y; He, Q; Liu, X; Du, L Z. Tyrosine phosphorylation of Kv1.5 is upregulated in intrauterine growth retardation rats with exaggerated pulmonary hypertension. Brazilian Journal Of Medical And Biological Research = Revista Brasileira De Pesquisas Medicas E Biologicas. 2017;50(11):e6237.